Lineage for d5a0zb_ (5a0z B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097778Fold c.7: PFL-like glycyl radical enzymes [51997] (1 superfamily)
    contains: barrel, closed; n=10, S=10; accommodates a hairpin loop inside the barrel
  4. 2097779Superfamily c.7.1: PFL-like glycyl radical enzymes [51998] (6 families) (S)
    duplication: the N- and C-terminal halves have similar topologies
  5. 2097868Family c.7.1.0: automated matches [275322] (1 protein)
    not a true family
  6. 2097869Protein automated matches [275324] (2 species)
    not a true protein
  7. 2097870Species Klebsiella pneumoniae [TaxId:573] [275326] (2 PDB entries)
  8. 2097880Domain d5a0zb_: 5a0z B: [275335]
    automated match to d1r9da_

Details for d5a0zb_

PDB Entry: 5a0z (more details), 3 Å

PDB Description: structure of cutc choline lyase choline free form from klebsiella pneumoniae
PDB Compounds: (B:) choline trimethylamine lyase

SCOPe Domain Sequences for d5a0zb_:

Sequence, based on SEQRES records: (download)

>d5a0zb_ c.7.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
megltprmqrlrnhyltvrpsvsiyralaftevvkanpgmptillrakafrhacetapil
iqddelivghpcgkpragafspdiawrwvrdeldtmstrpqdpfeiseadkktireeivp
fwegrsldeiceaqyreagvwafsgetfvsdlsyhqingggdtcpgydvllftkgmngik
adaeahlaslsmenpedidriyyykaaietcegvvnyarriaaharelaakeqnaqrrae
lltiaevnenvpanppktlqealqsiwtveslfeieenqtglslgrvdqycypmfeadir
egrlthdtalellqafiikcaelmwmsselgakyfagyqpfinltvggqkrsggdacndl
tylimdavrfvkvyqpslacrihnqspqkymekivdvvkagmgfpachfddshikmmlrk
gfdfedardyclmgcvepqksgriyqwtstgytqwpiaiefvlnrgrmvlfdsyqgldtg
dlrdlrtfdefdaavkqqiahivrlsaigtvisqrvhrdvapkplmsllvegcmesgkdv
aaggamvnhgpglifsglatyvdsmaairklvfeekkytleqirdallanfegyealrrd
clnapkygnddnyvdqyalditewtekecrkykmlystlshgtlsisnntpigeltnatp
ngrlawmplsdgisptqgadkqgptaiiksvskmnvetmnigmvhnfkflkglldtpegr
hglitllrtasilgngqmqfsyvdnevlkkaqqepekyrdlivrvagysayfvelckevq
deiisrtviekf

Sequence, based on observed residues (ATOM records): (download)

>d5a0zb_ c.7.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
megltprmqrlrnhyltvrpsvsiyralaftevvkanpgmptillrakafrhacetapil
iqddelivghpcgkpragafspdiawrwvrdeldtmstrpqdpfeiseadkktireeivp
fwegrsldeiceaqyreagvwafsgetfvsdlsyhqingggdtcpgydvllftkgmngik
adaeahlaslsmenpedidriyyykaaietcegvvnyarriaaharelaakeqnaqrrae
lltiaevnenvpanppktlqealqsiwtveslfeieenqtglslgrvdqycypmfeadir
egrlthdtalellqafiikcaelmwmsselgakyfagyqpfinltvggqkrsggdacndl
tylimdavrfvkvyqpslacrihnqspqkymekivdvvkagmgfpachfddshikmmlrk
gfdfedardyclmgcvepqksgriyqwtstgytqwpiaiefvlnrgrmvlfdsyqgldtg
dlrdlrtfdefdaavkqqiahivrlsaigtvisqrvhrdvapkplmsllvegcmesgkdv
aaggamvnhgpglifsglatyvdsmaairklveqirdallanfegyealrrdcldnyvdq
yalditewtekecrkykmlystlshgtlntpigeltnatpngrlawmpldkqgptaiikn
fkflkglldtpegrhglitllrtasilgngqmqfsyvdnevlkkaqqepekyrdlivrva
gysayfvelckevqdeiisrtviekf

SCOPe Domain Coordinates for d5a0zb_:

Click to download the PDB-style file with coordinates for d5a0zb_.
(The format of our PDB-style files is described here.)

Timeline for d5a0zb_: