SCOPe 2.08: Domain d4zd3l2: 4zd3 L:127-227

Lineage for d4zd3l2 (4zd3 L:127-227)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4zd3l2: 4zd3 L:127-227 [275319]
   Other proteins in same PDB: d4zd3h_, d4zd3l1
   automated match to d1dn0a2

Details for d4zd3l2

PDB Entry: 4zd3, 2.4 Å

PDB Description: structure of a transglutaminase 2-specific autoantibody fab fragment

PDB Compounds: (L:) 679-14-14E06 Fab fragment light chain

SCOPe Domain Sequences for d4zd3l2:

Sequence, based on SEQRES records:

>d4zd3l2 b.1.1.2 (L:127-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtk

Sequence, based on observed residues (ATOM records):

>d4zd3l2 b.1.1.2 (L:127-227) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdsgnsqesvteqdskd
styslsstltlskadyekhkvyacevthqglsspvtk

Timeline for d4zd3l2:

• d4zd3l2 first appeared in SCOPe 2.05
  
• d4zd3l2 appears in SCOPe 2.07