SCOPe 2.06: Domain d4zyca_: 4zyc A:

Lineage for d4zyca_ (4zyc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (59 PDB entries)

8. Domain d4zyca_: 4zyc A: [275315]
   automated match to d3jzra_
   complexed with 4ss, so4

Details for d4zyca_

PDB Entry: 4zyc, 1.95 Å

PDB Description: discovery of dihydroisoquinolinone derivatives as novel inhibitors of the p53-mdm2 interaction with a distinct binding mode: hdm2 (mdm2) complexed with cpd5

PDB Compounds: (A:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4zyca_:

Sequence; same for both SEQRES and ATOM records:

>d4zyca_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlv

Timeline for d4zyca_:

• d4zyca_ first appeared in SCOPe 2.05
  
• d4zyca_ appears in SCOPe 2.07
  
• d4zyca_ appears in the current release, SCOPe 2.08