SCOPe 2.05: Domain d4zxxl_: 4zxx L:

Lineage for d4zxxl_ (4zxx L:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4zxxl_: 4zxx L: [275313]
   Other proteins in same PDB: d4zxxh_
   automated match to d1cvwl_
   complexed with 4t0, ca, so4

Details for d4zxxl_

PDB Entry: 4zxx, 2.6 Å

PDB Description: factor viia in complex with the inhibitor n-{3-[(2r)-1-{(2r)-2-[(1- aminoisoquinolin-6-yl)amino]-2-phenylacetyl}pyrrolidin-2-yl]-4- (propan-2-ylsulfonyl)phenyl}acetamide

PDB Compounds: (L:) Coagulation factor VIIA light chain

SCOPe Domain Sequences for d4zxxl_:

Sequence; same for both SEQRES and ATOM records:

>d4zxxl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4zxxl_:

• d4zxxl_ is new in SCOPe 2.05-stable
  
• d4zxxl_ appears in SCOPe 2.06
  
• d4zxxl_ appears in the current release, SCOPe 2.08