SCOPe 2.05: Domain d4zu2a_: 4zu2 A:

Lineage for d4zu2a_ (4zu2 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (49 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [275309] (1 PDB entry)

8. Domain d4zu2a_: 4zu2 A: [275311]
   automated match to d4k3wb_
   complexed with iod

Details for d4zu2a_

PDB Entry: 4zu2, 2.15 Å

PDB Description: pseudomonas aeruginosa atue

PDB Compounds: (A:) Putative isohexenylglutaconyl-CoA hydratase

SCOPe Domain Sequences for d4zu2a_:

Sequence; same for both SEQRES and ATOM records:

>d4zu2a_ c.14.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
etlllepiegvlritlnrpqsrnamslamvgelravlaavrddrsvralvlrgadghfca
ggdikdmagaraagaeayrtlnrafgslleeaqaapqllvalvegavlgggfglacvsdv
aiaaadaqfglpetslgilpaqiapfvvrrigltqarrlaltaarfdgrealrlglvhfc
eadadaleqrleetleqlrrcapnanaatkalllasesgelgallddaarqfaeavggae
gsegtlafvqkrkpvwaq

Timeline for d4zu2a_:

• d4zu2a_ is new in SCOPe 2.05-stable
  
• d4zu2a_ appears in SCOPe 2.06
  
• d4zu2a_ appears in the current release, SCOPe 2.08