| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein cAMP-dependent PK, catalytic subunit [56116] (7 species) AGC group; PKA subfamily; serine/threonine kinase |
| Species Mouse (Mus musculus) [TaxId:10090] [56119] (33 PDB entries) |
| Domain d4x6ra_: 4x6r A: [275301] automated match to d1smha_ complexed with atp, gol, mg, myr, so4, tam |
PDB Entry: 4x6r (more details), 2.4 Å
SCOPe Domain Sequences for d4x6ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x6ra_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gnaaaackgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
Timeline for d4x6ra_: