SCOPe 2.05: Domain d1qhua1: 1qhu A:24-215

Lineage for d1qhua1 (1qhu A:24-215)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Hemopexin [50925] (1 species)
   duplication: consists of two domains of this fold

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)

8. Domain d1qhua1: 1qhu A:24-215 [27530]
   complexed with cl, hem, na, po4

Details for d1qhua1

PDB Entry: 1qhu, 2.3 Å

PDB Description: mammalian blood serum haemopexin deglycosylated and in complex with its ligand haem

PDB Compounds: (A:) protein (hemopexin)

SCOPe Domain Sequences for d1qhua1:

Sequence, based on SEQRES records:

>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ieqcsdgwsfdattlddngtmlffkdefvwkshrgireliserwknfigpvdaafrhght
svylikgdkvwvytseknekvypkslqdefpgipfpldaavechrgecqdegilffqgnr
kwfwdlttgtkkerswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrd
yflscpgrghrs

Sequence, based on observed residues (ATOM records):

>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ieqcsdgwsfdattlddngtmlffkdefvwkshrgireliserwknfigpvdaafrhght
svylikgdkvwvytspkslqdefpgipfpldaavechrgecqdegilffqgnrkwfwdlt
tgtkkerswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrdyflscpg
rghrs

Timeline for d1qhua1:

• d1qhua1 first appeared (with stable ids) in SCOP 1.55
  
• d1qhua1 appears in SCOPe 2.04
  
• d1qhua1 appears in SCOPe 2.06
  
• d1qhua1 appears in the current release, SCOPe 2.08