Lineage for d1qhua1 (1qhu A:24-215)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064751Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2064752Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2064753Family b.66.1.1: Hemopexin-like domain [50924] (6 protein domains)
  6. 2064774Protein Hemopexin [50925] (1 species)
    duplication: consists of two domains of this fold
  7. 2064775Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)
  8. 2064777Domain d1qhua1: 1qhu A:24-215 [27530]
    complexed with cl, hem, na, po4

Details for d1qhua1

PDB Entry: 1qhu (more details), 2.3 Å

PDB Description: mammalian blood serum haemopexin deglycosylated and in complex with its ligand haem
PDB Compounds: (A:) protein (hemopexin)

SCOPe Domain Sequences for d1qhua1:

Sequence, based on SEQRES records: (download)

>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ieqcsdgwsfdattlddngtmlffkdefvwkshrgireliserwknfigpvdaafrhght
svylikgdkvwvytseknekvypkslqdefpgipfpldaavechrgecqdegilffqgnr
kwfwdlttgtkkerswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrd
yflscpgrghrs

Sequence, based on observed residues (ATOM records): (download)

>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ieqcsdgwsfdattlddngtmlffkdefvwkshrgireliserwknfigpvdaafrhght
svylikgdkvwvytspkslqdefpgipfpldaavechrgecqdegilffqgnrkwfwdlt
tgtkkerswpavgnctsalrwlgryycfqgnqflrfnpvsgevppgypldvrdyflscpg
rghrs

SCOPe Domain Coordinates for d1qhua1:

Click to download the PDB-style file with coordinates for d1qhua1.
(The format of our PDB-style files is described here.)

Timeline for d1qhua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhua2