Lineage for d4wwyb_ (4wwy B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065921Species Human (Homo sapiens) [TaxId:9606] [50519] (4 PDB entries)
  8. 2065925Domain d4wwyb_: 4wwy B: [275294]
    Other proteins in same PDB: d4wwyc_, d4wwyi_
    automated match to d2ra3a_
    complexed with ca, so4; mutant

Details for d4wwyb_

PDB Entry: 4wwy (more details), 1.7 Å

PDB Description: human cationic trypsin g193r mutant in complex with bovine pancreatic trypsin inhibitor
PDB Compounds: (B:) Trypsin-1

SCOPe Domain Sequences for d4wwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wwyb_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]}
ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg
neqfinaakiirhpqydrktlnndimliklssravinahvstislptappatgtkclisg
wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqrdsggp
vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

SCOPe Domain Coordinates for d4wwyb_:

Click to download the PDB-style file with coordinates for d4wwyb_.
(The format of our PDB-style files is described here.)

Timeline for d4wwyb_: