Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [50519] (4 PDB entries) |
Domain d4wwyb_: 4wwy B: [275294] Other proteins in same PDB: d4wwyc_, d4wwyi_ automated match to d2ra3a_ complexed with ca, so4; mutant |
PDB Entry: 4wwy (more details), 1.7 Å
SCOPe Domain Sequences for d4wwyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wwyb_ b.47.1.2 (B:) Trypsin(ogen) {Human (Homo sapiens) [TaxId: 9606]} ivggynceensvpyqvslnsgyhfcggslineqwvvsaghcyksriqvrlgehnievleg neqfinaakiirhpqydrktlnndimliklssravinahvstislptappatgtkclisg wgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqrdsggp vvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans
Timeline for d4wwyb_: