SCOPe 2.06: Domain d1hxna_: 1hxn A:

Lineage for d1hxna_ (1hxn A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
   consists of four 4-stranded beta-sheet motifs; meander

4. Superfamily b.66.1: Hemopexin-like domain [50923] (2 families)

5. Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)

6. Protein Hemopexin [50925] (1 species)
   duplication: consists of two domains of this fold

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)

8. Domain d1hxna_: 1hxn A: [27529]
   C-terminal domain
   complexed with cl, na, po4

Details for d1hxna_

PDB Entry: 1hxn, 1.8 Å

PDB Description: 1.8 angstroms crystal structure of the c-terminal domain of rabbit serum hemopexin

PDB Compounds: (A:) hemopexin

SCOPe Domain Sequences for d1hxna_:

Sequence; same for both SEQRES and ATOM records:

>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
estrcdpdlvlsamvsdnhgatyvfsgshywrldtnrdgwhswpiahqwpqgpstvdaaf
swedklyliqdtkvyvfltkggytlvngypkrlekelgsppvisleavdaafvcpgssrl
himagrrlwwldlksgaqatwtelpwphekvdgalcmekplgpnscstsgpnlylihgpn
lycyrhvdklnaaknlpqpqrvsrllgcth

Timeline for d1hxna_:

• d1hxna_ first appeared (with stable ids) in SCOP 1.55, called d1hxn__
  
• d1hxna_ appears in SCOPe 2.05
  
• d1hxna_ appears in SCOPe 2.07
  
• d1hxna_ appears in the current release, SCOPe 2.08