Lineage for d1hxna_ (1hxn A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064751Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2064752Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2064753Family b.66.1.1: Hemopexin-like domain [50924] (6 protein domains)
  6. 2064774Protein Hemopexin [50925] (1 species)
    duplication: consists of two domains of this fold
  7. 2064775Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50926] (3 PDB entries)
  8. 2064776Domain d1hxna_: 1hxn A: [27529]
    C-terminal domain
    complexed with cl, na, po4

Details for d1hxna_

PDB Entry: 1hxn (more details), 1.8 Å

PDB Description: 1.8 angstroms crystal structure of the c-terminal domain of rabbit serum hemopexin
PDB Compounds: (A:) hemopexin

SCOPe Domain Sequences for d1hxna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
estrcdpdlvlsamvsdnhgatyvfsgshywrldtnrdgwhswpiahqwpqgpstvdaaf
swedklyliqdtkvyvfltkggytlvngypkrlekelgsppvisleavdaafvcpgssrl
himagrrlwwldlksgaqatwtelpwphekvdgalcmekplgpnscstsgpnlylihgpn
lycyrhvdklnaaknlpqpqrvsrllgcth

SCOPe Domain Coordinates for d1hxna_:

Click to download the PDB-style file with coordinates for d1hxna_.
(The format of our PDB-style files is described here.)

Timeline for d1hxna_: