Class b: All beta proteins [48724] (178 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
Protein automated matches [190094] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:381754] [275279] (1 PDB entry) |
Domain d4ut5b_: 4ut5 B: [275282] automated match to d4ce8a_ complexed with ca |
PDB Entry: 4ut5 (more details), 1.75 Å
SCOPe Domain Sequences for d4ut5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ut5b_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 381754]} atqgvftlpantrfgvtafanssatqtvkvlvnnetaatftgqstnnavigsqvlnsggg gkvqiqvsvngrssdlvsaqvilanelnvalvgsedstdndyndavvvinwplg
Timeline for d4ut5b_: