Lineage for d1f3uh_ (1f3u H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074467Fold b.65: triple barrel [50915] (1 superfamily)
    dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8
  4. 2074468Superfamily b.65.1: Rap30/74 interaction domains [50916] (1 family) (S)
  5. 2074469Family b.65.1.1: Rap30/74 interaction domains [50917] (2 proteins)
  6. 2074470Protein TFIIF alpha subunit, Rap74 [50920] (1 species)
  7. 2074471Species Human (Homo sapiens) [TaxId:9606] [50921] (1 PDB entry)
  8. 2074475Domain d1f3uh_: 1f3u H: [27528]
    Other proteins in same PDB: d1f3ua_, d1f3uc_, d1f3ue_, d1f3ug_

Details for d1f3uh_

PDB Entry: 1f3u (more details), 1.7 Å

PDB Description: crystal structure of the rap30/74 interaction domains of human tfiif
PDB Compounds: (H:) transcription initiation factor iif, alpha subunit

SCOPe Domain Sequences for d1f3uh_:

Sequence, based on SEQRES records: (download)

>d1f3uh_ b.65.1.1 (H:) TFIIF alpha subunit, Rap74 {Human (Homo sapiens) [TaxId: 9606]}
ssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkkiyqeeempesg
agsefnrklreearrkkygivlkefrpedqpwllrvngksgrkfkgikkggvtentsyyi
ftqcpdgafeafpvhnwynftplarhr

Sequence, based on observed residues (ATOM records): (download)

>d1f3uh_ b.65.1.1 (H:) TFIIF alpha subunit, Rap74 {Human (Homo sapiens) [TaxId: 9606]}
ssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkkiyqeeemrklr
eearrkkygivlkefrpedqpwllrvngksgrkfkgikkggvtentsyyiftqcpdgafe
afpvhnwynftplarhr

SCOPe Domain Coordinates for d1f3uh_:

Click to download the PDB-style file with coordinates for d1f3uh_.
(The format of our PDB-style files is described here.)

Timeline for d1f3uh_: