Class b: All beta proteins [48724] (176 folds) |
Fold b.65: triple barrel [50915] (1 superfamily) dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8 |
Superfamily b.65.1: Rap30/74 interaction domains [50916] (1 family) |
Family b.65.1.1: Rap30/74 interaction domains [50917] (2 proteins) |
Protein TFIIF alpha subunit, Rap74 [50920] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50921] (1 PDB entry) |
Domain d1f3uh_: 1f3u H: [27528] Other proteins in same PDB: d1f3ua_, d1f3uc_, d1f3ue_, d1f3ug_ |
PDB Entry: 1f3u (more details), 1.7 Å
SCOPe Domain Sequences for d1f3uh_:
Sequence, based on SEQRES records: (download)
>d1f3uh_ b.65.1.1 (H:) TFIIF alpha subunit, Rap74 {Human (Homo sapiens) [TaxId: 9606]} ssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkkiyqeeempesg agsefnrklreearrkkygivlkefrpedqpwllrvngksgrkfkgikkggvtentsyyi ftqcpdgafeafpvhnwynftplarhr
>d1f3uh_ b.65.1.1 (H:) TFIIF alpha subunit, Rap74 {Human (Homo sapiens) [TaxId: 9606]} ssqnvteyvvrvpknttkkynimafnaadkvnfatwnqarlerdlsnkkiyqeeemrklr eearrkkygivlkefrpedqpwllrvngksgrkfkgikkggvtentsyyiftqcpdgafe afpvhnwynftplarhr
Timeline for d1f3uh_: