Lineage for d4ut2b_ (4ut2 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998162Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2998173Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries)
    Uniprot P36873
  8. 2998181Domain d4ut2b_: 4ut2 B: [275277]
    automated match to d1jk7a_
    complexed with mn, po4

Details for d4ut2b_

PDB Entry: 4ut2 (more details), 1.96 Å

PDB Description: x-ray structure of the human pp1 gamma catalytic subunit treated with ascorbate
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

SCOPe Domain Sequences for d4ut2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ut2b_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d4ut2b_:

Click to download the PDB-style file with coordinates for d4ut2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ut2b_: