Lineage for d4um3x_ (4um3 X:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810768Protein automated matches [190922] (3 species)
    not a true protein
  7. 1810769Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (19 PDB entries)
  8. 1810977Domain d4um3x_: 4um3 X: [275273]
    automated match to d4alxa_
    complexed with 09r, nag, so4

Details for d4um3x_

PDB Entry: 4um3 (more details), 2.7 Å

PDB Description: engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
PDB Compounds: (X:) acetylcholine binding protein

SCOPe Domain Sequences for d4um3x_:

Sequence, based on SEQRES records: (download)

>d4um3x_ b.96.1.1 (X:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d4um3x_ b.96.1.1 (X:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeildvtqkknsv
tysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d4um3x_:

Click to download the PDB-style file with coordinates for d4um3x_.
(The format of our PDB-style files is described here.)

Timeline for d4um3x_: