![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
![]() | Protein automated matches [190922] (2 species) not a true protein |
![]() | Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (33 PDB entries) |
![]() | Domain d4um3f_: 4um3 F: [275254] automated match to d4alxa_ complexed with 09r, nag, so4 |
PDB Entry: 4um3 (more details), 2.7 Å
SCOPe Domain Sequences for d4um3f_:
Sequence, based on SEQRES records: (download)
>d4um3f_ b.96.1.1 (F:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkkg
>d4um3f_ b.96.1.1 (F:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrpvavsvslkfinilevneitnevdvvfwqqttwsdrt lawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqrfs cdvsgvdtesgatcrikigswthhsreisvdpteyfsqysrfeildvtqkknsvtysccp eayedvevslnfrkkg
Timeline for d4um3f_: