Lineage for d4um1a_ (4um1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073791Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2073792Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2073793Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 protein domains)
    automatically mapped to Pfam PF02931
  6. 2073887Protein automated matches [190922] (2 species)
    not a true protein
  7. 2073888Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (31 PDB entries)
  8. 2074144Domain d4um1a_: 4um1 A: [275247]
    automated match to d4alxa_
    complexed with 09p, nag

Details for d4um1a_

PDB Entry: 4um1 (more details), 2.83 Å

PDB Description: engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3573
PDB Compounds: (A:) acetylcholine-binding protein

SCOPe Domain Sequences for d4um1a_:

Sequence, based on SEQRES records: (download)

>d4um1a_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d4um1a_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlahvvsdgevqytpsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttdseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d4um1a_:

Click to download the PDB-style file with coordinates for d4um1a_.
(The format of our PDB-style files is described here.)

Timeline for d4um1a_: