SCOPe 2.06: Domain d4ua2c_: 4ua2 C:

Lineage for d4ua2c_ (4ua2 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (5 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries)

8. Domain d4ua2c_: 4ua2 C: [275242]
   automated match to d1q05b_

Details for d4ua2c_

PDB Entry: 4ua2, 2.61 Å

PDB Description: crystal structure of dual function transcriptional regulator merr from bacillus megaterium mb1

PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4ua2c_:

Sequence, based on SEQRES records:

>d4ua2c_ a.6.1.0 (C:) automated matches {Bacillus megaterium [TaxId: 1404]}
ketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftlneidkllgvvdrd
eakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiietlm

Sequence, based on observed residues (ATOM records):

>d4ua2c_ a.6.1.0 (C:) automated matches {Bacillus megaterium [TaxId: 1404]}
ketiryyerqtvdrlhfikrmqelgftlneidkllgvvdrdeakcrdmydftilkiediq
rkiedlkriermlmdlkercpenkdiyecpiietlm

Timeline for d4ua2c_:

• d4ua2c_ first appeared in SCOPe 2.05
  
• d4ua2c_ appears in SCOPe 2.07
  
• d4ua2c_ appears in the current release, SCOPe 2.08