Lineage for d4ua2c_ (4ua2 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696470Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2696471Protein automated matches [191102] (6 species)
    not a true protein
  7. 2696472Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries)
  8. 2696477Domain d4ua2c_: 4ua2 C: [275242]
    automated match to d1q05b_

Details for d4ua2c_

PDB Entry: 4ua2 (more details), 2.61 Å

PDB Description: crystal structure of dual function transcriptional regulator merr from bacillus megaterium mb1
PDB Compounds: (C:) Regulatory protein

SCOPe Domain Sequences for d4ua2c_:

Sequence, based on SEQRES records: (download)

>d4ua2c_ a.6.1.0 (C:) automated matches {Bacillus megaterium [TaxId: 1404]}
ketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftlneidkllgvvdrd
eakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiietlm

Sequence, based on observed residues (ATOM records): (download)

>d4ua2c_ a.6.1.0 (C:) automated matches {Bacillus megaterium [TaxId: 1404]}
ketiryyerqtvdrlhfikrmqelgftlneidkllgvvdrdeakcrdmydftilkiediq
rkiedlkriermlmdlkercpenkdiyecpiietlm

SCOPe Domain Coordinates for d4ua2c_:

Click to download the PDB-style file with coordinates for d4ua2c_.
(The format of our PDB-style files is described here.)

Timeline for d4ua2c_: