![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.0: automated matches [191604] (1 protein) not a true family |
![]() | Protein automated matches [191102] (6 species) not a true protein |
![]() | Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries) |
![]() | Domain d4ua2f_: 4ua2 F: [275240] automated match to d1q05b_ |
PDB Entry: 4ua2 (more details), 2.61 Å
SCOPe Domain Sequences for d4ua2f_:
Sequence, based on SEQRES records: (download)
>d4ua2f_ a.6.1.0 (F:) automated matches {Bacillus megaterium [TaxId: 1404]} igeladkcgvnketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftlne idkllgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecp iietlm
>d4ua2f_ a.6.1.0 (F:) automated matches {Bacillus megaterium [TaxId: 1404]} igeladkcgvnketiryyerlglipepmysqqtvdrlhfikrmqelgftlneidkllgvv drdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiietlm
Timeline for d4ua2f_: