Class b: All beta proteins [48724] (177 folds) |
Fold b.65: triple barrel [50915] (1 superfamily) dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8 |
Superfamily b.65.1: Rap30/74 interaction domains [50916] (1 family) |
Family b.65.1.1: Rap30/74 interaction domains [50917] (2 proteins) |
Protein TFIIF beta subunit, Rap30 [50918] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50919] (1 PDB entry) |
Domain d1f3ug_: 1f3u G: [27524] Other proteins in same PDB: d1f3ub_, d1f3ud_, d1f3uf_, d1f3uh_ |
PDB Entry: 1f3u (more details), 1.7 Å
SCOPe Domain Sequences for d1f3ug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f3ug_ b.65.1.1 (G:) TFIIF beta subunit, Rap30 {Human (Homo sapiens) [TaxId: 9606]} aergeldltgakqntgvwlvkvpkylsqqwakasgrgevgklriaktqgrtevsftlned lanihdiggkpasvsaprehpfvlqsvggqtltvftesssdklslegivvqraecrpa
Timeline for d1f3ug_: