Lineage for d1f3ug_ (1f3u G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807206Fold b.65: triple barrel [50915] (1 superfamily)
    dimer of two non-identical subunits; forms two similar barrels, n=8, S=10 each, that are fused together with the formation of third barrel, n=6, S=8
  4. 2807207Superfamily b.65.1: Rap30/74 interaction domain-like [50916] (3 families) (S)
  5. 2807208Family b.65.1.1: Rap30/74 interaction domains [50917] (2 proteins)
  6. 2807215Protein TFIIF beta subunit, Rap30 [50918] (1 species)
  7. 2807216Species Human (Homo sapiens) [TaxId:9606] [50919] (1 PDB entry)
  8. 2807220Domain d1f3ug_: 1f3u G: [27524]
    Other proteins in same PDB: d1f3ub_, d1f3ud_, d1f3uf_, d1f3uh_

Details for d1f3ug_

PDB Entry: 1f3u (more details), 1.7 Å

PDB Description: crystal structure of the rap30/74 interaction domains of human tfiif
PDB Compounds: (G:) transcription initiation factor iif, beta subunit

SCOPe Domain Sequences for d1f3ug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ug_ b.65.1.1 (G:) TFIIF beta subunit, Rap30 {Human (Homo sapiens) [TaxId: 9606]}
aergeldltgakqntgvwlvkvpkylsqqwakasgrgevgklriaktqgrtevsftlned
lanihdiggkpasvsaprehpfvlqsvggqtltvftesssdklslegivvqraecrpa

SCOPe Domain Coordinates for d1f3ug_:

Click to download the PDB-style file with coordinates for d1f3ug_.
(The format of our PDB-style files is described here.)

Timeline for d1f3ug_: