SCOPe 2.07: Domain d4ua1a_: 4ua1 A:

Lineage for d4ua1a_ (4ua1 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (6 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries)

8. Domain d4ua1a_: 4ua1 A: [275238]
   automated match to d1q05b_
   protein/DNA complex; complexed with hg

Details for d4ua1a_

PDB Entry: 4ua1, 2.56 Å

PDB Description: crystal structure of dual function transcriptional regulator merr form bacillus megaterium mb1 in complex with mercury (ii) ion

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4ua1a_:

Sequence, based on SEQRES records:

>d4ua1a_ a.6.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
frigeladkcgvnketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftl
neidkllgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiye
cpiietlmk

Sequence, based on observed residues (ATOM records):

>d4ua1a_ a.6.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
frigeladkcgvnketiryyerlglipepekgyrmqqtvdrlhfikrmqelgftlneidk
llgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiie
tlmk

Timeline for d4ua1a_:

• d4ua1a_ first appeared in SCOPe 2.05
  
• d4ua1a_ appears in SCOPe 2.06
  
• d4ua1a_ appears in the current release, SCOPe 2.08