Lineage for d4ua1a_ (4ua1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696470Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2696471Protein automated matches [191102] (6 species)
    not a true protein
  7. 2696472Species Bacillus megaterium [TaxId:1404] [275234] (2 PDB entries)
  8. 2696473Domain d4ua1a_: 4ua1 A: [275238]
    automated match to d1q05b_
    protein/DNA complex; complexed with hg

Details for d4ua1a_

PDB Entry: 4ua1 (more details), 2.56 Å

PDB Description: crystal structure of dual function transcriptional regulator merr form bacillus megaterium mb1 in complex with mercury (ii) ion
PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d4ua1a_:

Sequence, based on SEQRES records: (download)

>d4ua1a_ a.6.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
frigeladkcgvnketiryyerlglipepertekgyrmysqqtvdrlhfikrmqelgftl
neidkllgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiye
cpiietlmk

Sequence, based on observed residues (ATOM records): (download)

>d4ua1a_ a.6.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
frigeladkcgvnketiryyerlglipepekgyrmqqtvdrlhfikrmqelgftlneidk
llgvvdrdeakcrdmydftilkiediqrkiedlkriermlmdlkercpenkdiyecpiie
tlmk

SCOPe Domain Coordinates for d4ua1a_:

Click to download the PDB-style file with coordinates for d4ua1a_.
(The format of our PDB-style files is described here.)

Timeline for d4ua1a_: