Lineage for d4tyha_ (4tyh A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219935Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 2219936Species Human (Homo sapiens) [TaxId:9606] [82790] (15 PDB entries)
  8. 2219983Domain d4tyha_: 4tyh A: [275232]
    Other proteins in same PDB: d4tyhb_
    automated match to d1kwpa_
    complexed with 39g

Details for d4tyha_

PDB Entry: 4tyh (more details), 3 Å

PDB Description: ternary complex of p38 and mk2 with a p38 inhibitor
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d4tyha_:

Sequence, based on SEQRES records: (download)

>d4tyha_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
apevlgpekydkscdmwslgvimyillcgyppfysnhglaispgmktrirmgqyefpnpe
wsevseevkmlirnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwe
dvkeemtsalatmrvdyeqikikkiedasnplllkrrkkaraleaaalah

Sequence, based on observed residues (ATOM records): (download)

>d4tyha_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
glqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarrevelhwr
asqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereaseimksi
geaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettshnslttpcytpyyv
apevlgpekydkscdmwslgvimyillcgyppfysnhgrmgqyefpnpewsevseevkml
irnllkteptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsala
tmrvdyeqikikkiedasnplllkrrkkaraleaaalah

SCOPe Domain Coordinates for d4tyha_:

Click to download the PDB-style file with coordinates for d4tyha_.
(The format of our PDB-style files is described here.)

Timeline for d4tyha_: