Lineage for d4qwpa_ (4qwp A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888833Family d.2.1.7: Chitosanase [53996] (2 proteins)
    automatically mapped to Pfam PF01374
  6. 1888841Protein automated matches [230243] (3 species)
    not a true protein
  7. 1888842Species Pseudomonas sp. [TaxId:201382] [275208] (1 PDB entry)
  8. 1888843Domain d4qwpa_: 4qwp A: [275210]
    automated match to d4oltb_
    complexed with act, gol

Details for d4qwpa_

PDB Entry: 4qwp (more details), 1.7 Å

PDB Description: co-crystal structure of chitosanase ou01 with substrate
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d4qwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qwpa_ d.2.1.7 (A:) automated matches {Pseudomonas sp. [TaxId: 201382]}
gtvdldapvqkdtamslvssfensstdwqaqygylediaagrgytggligftsgtgdmle
lvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdr
vyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdet
eyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln

SCOPe Domain Coordinates for d4qwpa_:

Click to download the PDB-style file with coordinates for d4qwpa_.
(The format of our PDB-style files is described here.)

Timeline for d4qwpa_: