SCOPe 2.05: Domain d4qega_: 4qeg A:

Lineage for d4qega_ (4qeg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d4qega_: 4qeg A: [275204]
   automated match to d2e7ba_
   complexed with ca

Details for d4qega_

PDB Entry: 4qeg, 2 Å

PDB Description: crystal structure of domain i10 from titin (space group p41)

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d4qega_:

Sequence; same for both SEQRES and ATOM records:

>d4qega_ b.1.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
metlhitktmknievpetktasfecevshfnvpsmwlkngveiemsekfkivvqgklhql
iimntstedsaeytfvcgndqvsatltvt

Timeline for d4qega_:

• d4qega_ is new in SCOPe 2.05-stable
  
• d4qega_ is called d4qega1 in SCOPe 2.06
  
• d4qega_ appears in the current release, SCOPe 2.08, called d4qega1