SCOPe 2.08: Domain d4qega1: 4qeg A:2834-2921

Lineage for d4qega1 (4qeg A:2834-2921)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4qega1: 4qeg A:2834-2921 [275204]
   Other proteins in same PDB: d4qega2
   automated match to d2e7ba_
   complexed with ca

Details for d4qega1

PDB Entry: 4qeg, 2 Å

PDB Description: crystal structure of domain i10 from titin (space group p41)

PDB Compounds: (A:) titin

SCOPe Domain Sequences for d4qega1:

Sequence; same for both SEQRES and ATOM records:

>d4qega1 b.1.1.0 (A:2834-2921) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etlhitktmknievpetktasfecevshfnvpsmwlkngveiemsekfkivvqgklhqli
imntstedsaeytfvcgndqvsatltvt

Timeline for d4qega1:

• d4qega1 first appeared in SCOPe 2.05, called d4qega_
  
• d4qega1 appears in SCOPe 2.07