Lineage for d1m6pb_ (1m6p B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397805Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2397806Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2397807Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 protein domains)
  6. 2397808Protein Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain [50913] (1 species)
  7. 2397809Species Cow (Bos taurus) [TaxId:9913] [50914] (12 PDB entries)
  8. 2397817Domain d1m6pb_: 1m6p B: [27520]
    complexed with m6p, mn

Details for d1m6pb_

PDB Entry: 1m6p (more details), 1.8 Å

PDB Description: extracytoplasmic domain of bovine cation-dependent mannose 6-phosphate receptor
PDB Compounds: (B:) Cation-dependent mannose-6-phosphate receptor

SCOPe Domain Sequences for d1m6pb_:

Sequence, based on SEQRES records: (download)

>d1m6pb_ b.64.1.1 (B:) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus) [TaxId: 9913]}
ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
tladnfnpvseergkvqdcfylfemdsslacs

Sequence, based on observed residues (ATOM records): (download)

>d1m6pb_ b.64.1.1 (B:) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus) [TaxId: 9913]}
ektcdlvgekgkesekelallkrltplfqksfestmysyvfrvcreagqhssgaglvqiq
ksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrhtladnf
npvseergkvqdcfylfemdsslacs

SCOPe Domain Coordinates for d1m6pb_:

Click to download the PDB-style file with coordinates for d1m6pb_.
(The format of our PDB-style files is described here.)

Timeline for d1m6pb_: