Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (29 species) not a true protein |
Species Brucella melitensis [TaxId:520466] [255402] (1 PDB entry) |
Domain d2n57a_: 2n57 A: [275199] automated match to d2l3va_ |
PDB Entry: 2n57 (more details)
SCOPe Domain Sequences for d2n57a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n57a_ a.28.1.0 (A:) automated matches {Brucella melitensis [TaxId: 520466]} msdtaervkkivvehlgvdadkvtegasfiddlgadsldtvelvmafeeefgveipddaa etiltvgdavkfidkasa
Timeline for d2n57a_: