Lineage for d2n57a_ (2n57 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706260Species Brucella melitensis [TaxId:520466] [255402] (1 PDB entry)
  8. 2706261Domain d2n57a_: 2n57 A: [275199]
    automated match to d2l3va_

Details for d2n57a_

PDB Entry: 2n57 (more details)

PDB Description: nmr structure of acyl carrier protein from brucella melitensis
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2n57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n57a_ a.28.1.0 (A:) automated matches {Brucella melitensis [TaxId: 520466]}
msdtaervkkivvehlgvdadkvtegasfiddlgadsldtvelvmafeeefgveipddaa
etiltvgdavkfidkasa

SCOPe Domain Coordinates for d2n57a_:

Click to download the PDB-style file with coordinates for d2n57a_.
(The format of our PDB-style files is described here.)

Timeline for d2n57a_: