Lineage for d2n2ma_ (2n2m A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575840Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2575841Protein automated matches [191257] (5 species)
    not a true protein
  7. 2575870Species Yersinia pestis [TaxId:632] [189816] (4 PDB entries)
  8. 2575875Domain d2n2ma_: 2n2m A: [275198]
    automated match to d3qraa_

Details for d2n2ma_

PDB Entry: 2n2m (more details)

PDB Description: nmr structure of yersinia pestis ail (attachment invasion locus) in decylphosphocholine micelles
PDB Compounds: (A:) Outer membrane protein X

SCOPe Domain Sequences for d2n2ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n2ma_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
egessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvdg
fklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygag
lqfnphpnfvidasyeysklddvkvgtwmlgagyrf

SCOPe Domain Coordinates for d2n2ma_:

Click to download the PDB-style file with coordinates for d2n2ma_.
(The format of our PDB-style files is described here.)

Timeline for d2n2ma_: