Lineage for d5ci5a_ (5ci5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523412Species Pseudothermotoga lettingae [TaxId:416591] [275191] (1 PDB entry)
  8. 2523413Domain d5ci5a_: 5ci5 A: [275194]
    automated match to d3uora_
    complexed with 1pe, edo, t6t

Details for d5ci5a_

PDB Entry: 5ci5 (more details), 1.61 Å

PDB Description: crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
PDB Compounds: (A:) Extracellular solute-binding protein family 1

SCOPe Domain Sequences for d5ci5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ci5a_ c.94.1.0 (A:) automated matches {Pseudothermotoga lettingae [TaxId: 416591]}
sktltiwiggqvaeldetwnsviktfeekygisvevqlfgfdtyydklvtalqagkgpdl
afadlggwvptfaekgwlepmeehlknwegtaqiwpnlwptvtykkiryglpwytdcrll
lynkamfekaglnpdnppktwdelldaalkitdtknriygygvsgtktehttlgymmfly
aaggklltddyskaafdspeglkalkfytdlakkynvspnaiqyheddyrnmmaqnrvam
aiggpwsfplieaanpdiagkysvalhpydakpasvlggwalvipssspnkedawklaey
ltsfdvwmkwveekggpmptrmdvckksklandvkwqiifetfphavarppipqypqise
qiqtmvqrvllgeltpeeaikiaaenvnkilga

SCOPe Domain Coordinates for d5ci5a_:

Click to download the PDB-style file with coordinates for d5ci5a_.
(The format of our PDB-style files is described here.)

Timeline for d5ci5a_: