Lineage for d5cf9b_ (5cf9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2999983Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 2999984Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (10 PDB entries)
  8. 2999986Domain d5cf9b_: 5cf9 B: [275188]
    automated match to d1ahca_
    complexed with nag, nca

Details for d5cf9b_

PDB Entry: 5cf9 (more details), 1.52 Å

PDB Description: cleavage of nicotinamide adenine dinucleotide by the ribosome inactivating protein of momordica charantia - enzyme-nadp+ co- crystallisation.
PDB Compounds: (B:) Ribosome-inactivating protein momordin I

SCOPe Domain Sequences for d5cf9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cf9b_ d.165.1.1 (B:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOPe Domain Coordinates for d5cf9b_:

Click to download the PDB-style file with coordinates for d5cf9b_.
(The format of our PDB-style files is described here.)

Timeline for d5cf9b_: