SCOPe 2.05: Domain d5caif_: 5cai F:

Lineage for d5caif_ (5cai F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (10 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [275179] (1 PDB entry)

8. Domain d5caif_: 5cai F: [275185]
   automated match to d2rd1b_
   complexed with cl

Details for d5caif_

PDB Entry: 5cai, 2.3 Å

PDB Description: crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution

PDB Compounds: (F:) Putative lipoprotein from the DUF903 family

SCOPe Domain Sequences for d5caif_:

Sequence; same for both SEQRES and ATOM records:

>d5caif_ b.38.1.0 (F:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

Timeline for d5caif_:

• d5caif_ is new in SCOPe 2.05-stable
  
• d5caif_ appears in SCOPe 2.06
  
• d5caif_ appears in the current release, SCOPe 2.08