Lineage for d5caib_ (5cai B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (13 species)
    not a true protein
  7. 2381185Species Klebsiella pneumoniae [TaxId:272620] [275179] (1 PDB entry)
  8. 2381187Domain d5caib_: 5cai B: [275182]
    automated match to d2rd1b_
    complexed with cl

Details for d5caib_

PDB Entry: 5cai (more details), 2.3 Å

PDB Description: crystal structure of a putative lipoprotein from the duf903 family (kpn_03160) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 2.30 a resolution
PDB Compounds: (B:) Putative lipoprotein from the DUF903 family

SCOPe Domain Sequences for d5caib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5caib_ b.38.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ssnyvmhtndgrtivtdgkpqtdndtgmisykdawgnkqqinrsdvkqlgeld

SCOPe Domain Coordinates for d5caib_:

Click to download the PDB-style file with coordinates for d5caib_.
(The format of our PDB-style files is described here.)

Timeline for d5caib_: