Lineage for d1c39b_ (1c39 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62658Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
  4. 62659Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 62660Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (2 proteins)
  6. 62661Protein Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain [50913] (1 species)
  7. 62662Species Cow (Bos taurus) [TaxId:9913] [50914] (2 PDB entries)
  8. 62664Domain d1c39b_: 1c39 B: [27518]

Details for d1c39b_

PDB Entry: 1c39 (more details), 1.85 Å

PDB Description: structure of cation-dependent mannose 6-phosphate receptor bound to pentamannosyl phosphate

SCOP Domain Sequences for d1c39b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c39b_ b.64.1.1 (B:) Cation-dependent mannose 6-phosphate receptor, extracytoplasmic domain {Cow (Bos taurus)}
ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
tladnfnpvseergkvqdcfylfemdsslacs

SCOP Domain Coordinates for d1c39b_:

Click to download the PDB-style file with coordinates for d1c39b_.
(The format of our PDB-style files is described here.)

Timeline for d1c39b_: