Lineage for d5c8gb_ (5c8g B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708321Species Trypanosoma brucei [TaxId:679716] [275175] (2 PDB entries)
  8. 2708324Domain d5c8gb_: 5c8g B: [275178]
    automated match to d4a9ib_
    complexed with r78, unx

Details for d5c8gb_

PDB Entry: 5c8g (more details), 1.95 Å

PDB Description: crystal structure analysis of pp-brd20 from tb427tmp complexed with bi-2536
PDB Compounds: (B:) pp-brd20

SCOPe Domain Sequences for d5c8gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c8gb_ a.29.2.0 (B:) automated matches {Trypanosoma brucei [TaxId: 679716]}
nkhvfhsdqrlapeirdlydclyklyaeesaseyfrepvdalrvgawnyysvitepmslr
tvldyivqggryshveqimndveliwknceryngaeshlaadarrcrailekhrerla

SCOPe Domain Coordinates for d5c8gb_:

Click to download the PDB-style file with coordinates for d5c8gb_.
(The format of our PDB-style files is described here.)

Timeline for d5c8gb_: