SCOPe 2.07: Domain d5brlb_: 5brl B:

Lineage for d5brlb_ (5brl B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [275171] (1 PDB entry)

8. Domain d5brlb_: 5brl B: [275174]
   automated match to d2r55a_

Details for d5brlb_

PDB Entry: 5brl, 2 Å

PDB Description: crystal structure of l124d stard4

PDB Compounds: (B:) StAR-related lipid transfer protein 4

SCOPe Domain Sequences for d5brlb_:

Sequence; same for both SEQRES and ATOM records:

>d5brlb_ d.129.3.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq
gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref
vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd
lrgmipqsavdtamastlanfysdlrkglr

Timeline for d5brlb_:

• d5brlb_ first appeared in SCOPe 2.05
  
• d5brlb_ appears in SCOPe 2.06
  
• d5brlb_ appears in the current release, SCOPe 2.08