Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [275171] (1 PDB entry) |
Domain d5brla_: 5brl A: [275173] automated match to d2r55a_ |
PDB Entry: 5brl (more details), 2 Å
SCOPe Domain Sequences for d5brla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5brla_ d.129.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngylykaq gvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqldniispref vdfsytvgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtd lrgmipqsavdtamastlanfysdlrkglr
Timeline for d5brla_: