![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d5a3id1: 5a3i D:1-111 [275169] Other proteins in same PDB: d5a3ia1, d5a3ia2, d5a3ib_, d5a3id2, d5a3ie1, d5a3ie2, d5a3if_, d5a3ih2 automated match to d1dn0a1 complexed with nag; mutant |
PDB Entry: 5a3i (more details), 2.89 Å
SCOPe Domain Sequences for d5a3id1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a3id1 b.1.1.0 (D:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkvei
Timeline for d5a3id1: