Lineage for d5a3id1 (5a3i D:1-111)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1764974Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)
  8. 1765160Domain d5a3id1: 5a3i D:1-111 [275169]
    Other proteins in same PDB: d5a3ia_, d5a3ib_, d5a3id2, d5a3ie_, d5a3if_, d5a3ih2
    automated match to d1dn0a1
    complexed with nag; mutant

Details for d5a3id1

PDB Entry: 5a3i (more details), 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
PDB Compounds: (D:) anti-haemagglutinin ha1 fab light chain

SCOPe Domain Sequences for d5a3id1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3id1 b.1.1.0 (D:1-111) automated matches {Homo sapiens [TaxId: 9606]}
divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkvei

SCOPe Domain Coordinates for d5a3id1:

Click to download the PDB-style file with coordinates for d5a3id1.
(The format of our PDB-style files is described here.)

Timeline for d5a3id1: