Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries) |
Domain d5a3id1: 5a3i D:1-111 [275169] Other proteins in same PDB: d5a3ia_, d5a3ib_, d5a3id2, d5a3ie_, d5a3if_, d5a3ih2 automated match to d1dn0a1 complexed with nag; mutant |
PDB Entry: 5a3i (more details), 2.89 Å
SCOPe Domain Sequences for d5a3id1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a3id1 b.1.1.0 (D:1-111) automated matches {Homo sapiens [TaxId: 9606]} divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkvei
Timeline for d5a3id1: