Lineage for d5a3ih2 (5a3i H:112-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751535Domain d5a3ih2: 5a3i H:112-218 [275168]
    Other proteins in same PDB: d5a3ia1, d5a3ia2, d5a3ib_, d5a3ic_, d5a3id1, d5a3ie1, d5a3ie2, d5a3if_, d5a3ig_, d5a3ih1
    automated match to d1dn0a2
    complexed with nag; mutant

Details for d5a3ih2

PDB Entry: 5a3i (more details), 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
PDB Compounds: (H:) anti-haemagglutinin ha1 fab light chain

SCOPe Domain Sequences for d5a3ih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3ih2 b.1.1.2 (H:112-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5a3ih2:

Click to download the PDB-style file with coordinates for d5a3ih2.
(The format of our PDB-style files is described here.)

Timeline for d5a3ih2: