SCOPe 2.06: Domain d5a3ih1: 5a3i H:1-111

Lineage for d5a3ih1 (5a3i H:1-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5a3ih1: 5a3i H:1-111 [275167]
   Other proteins in same PDB: d5a3ia1, d5a3ia2, d5a3ib_, d5a3id2, d5a3ie1, d5a3ie2, d5a3if_, d5a3ih2
   automated match to d1dn0a1
   complexed with nag; mutant

Details for d5a3ih1

PDB Entry: 5a3i, 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin

PDB Compounds: (H:) anti-haemagglutinin ha1 fab light chain

SCOPe Domain Sequences for d5a3ih1:

Sequence; same for both SEQRES and ATOM records:

>d5a3ih1 b.1.1.0 (H:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvspgepasiscrssqsllhgngynyldwylqkpgqsprlliylgsnra
sgvpdrfsgsgsgtdftlkisrveaedvgvyycmqalqtpltfgggtkvei

Timeline for d5a3ih1:

• d5a3ih1 first appeared in SCOPe 2.05
  
• d5a3ih1 appears in SCOPe 2.07
  
• d5a3ih1 appears in the current release, SCOPe 2.08