Lineage for d5a5ra1 (5a5r A:981-1108)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2321296Domain d5a5ra1: 5a5r A:981-1108 [275165]
    Other proteins in same PDB: d5a5ra2
    automated match to d4tz2a_
    complexed with edo, np8, so4

Details for d5a5ra1

PDB Entry: 5a5r (more details), 2.01 Å

PDB Description: crystal structure of human atad2 bromodomain in complex with 5-5-methoxypyridin-3-yl-3-methyl-8-piperidin-4- ylamino-1,2-dihydro-1,7-naphthyridin-2-one
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d5a5ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a5ra1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

SCOPe Domain Coordinates for d5a5ra1:

Click to download the PDB-style file with coordinates for d5a5ra1.
(The format of our PDB-style files is described here.)

Timeline for d5a5ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a5ra2