SCOPe 2.05: Domain d5a5na_: 5a5n A:

Lineage for d5a5na_ (5a5n A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d5a5na_: 5a5n A: [275164]
   automated match to d4tz2a_
   complexed with 8ws, edo, so4

Details for d5a5na_

PDB Entry: 5a5n, 1.95 Å

PDB Description: crystal structure of human atad2 bromodomain in complex with (2s)-2,6-diacetamido-n-methylhexanamide

PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d5a5na_:

Sequence; same for both SEQRES and ATOM records:

>d5a5na_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smqeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviski
dlhkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfe
qlceeiqesr

Timeline for d5a5na_:

• d5a5na_ is new in SCOPe 2.05-stable
  
• d5a5na_ is called d5a5na1 in SCOPe 2.06
  
• d5a5na_ appears in the current release, SCOPe 2.08, called d5a5na1