Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId:644788] [256161] (6 PDB entries) |
Domain d5a3if_: 5a3i F: [275160] Other proteins in same PDB: d5a3ia1, d5a3ia2, d5a3ic_, d5a3id1, d5a3id2, d5a3ie1, d5a3ie2, d5a3ig_, d5a3ih1, d5a3ih2 automated match to d2fk0b1 complexed with nag; mutant |
PDB Entry: 5a3i (more details), 2.89 Å
SCOPe Domain Sequences for d5a3if_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a3if_ h.3.1.1 (F:) automated matches {Influenza A virus (a/vietnam/1194/2004(h5n1)) [TaxId: 644788]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgkefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
Timeline for d5a3if_: