SCOPe 2.06: Domain d1qtta_: 1qtt A:

Lineage for d1qtta_ (1qtt A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.63: Oncogene products [50903] (1 superfamily)
   barrel, closed; n=8, S=10; one overside connection

4. Superfamily b.63.1: Oncogene products [50904] (1 family)
   duplication: N- and C-terminal halves are related by pseudo dyad
   automatically mapped to Pfam PF01840

5. Family b.63.1.1: Oncogene products [50905] (2 proteins)

6. Protein p13-MTCP1 [50908] (1 species)
   involved in T cell malignancies

7. Species Human (Homo sapiens) [TaxId:9606] [50909] (3 PDB entries)

8. Domain d1qtta_: 1qtt A: [27516]

Details for d1qtta_

PDB Entry: 1qtt

PDB Description: solution structure of the oncoprotein p13mtcp1

PDB Compounds: (A:) product of the mtcp1 oncogene

SCOPe Domain Sequences for d1qtta_:

Sequence; same for both SEQRES and ATOM records:

>d1qtta_ b.63.1.1 (A:) p13-MTCP1 {Human (Homo sapiens) [TaxId: 9606]}
gsmagedvgappdhlwvhqegiyrdeyqrtwvavveeetsflrarvqqiqvplgdaarps
hlltsqlplmwqlypeerymdnnsrlwqiqhhlmvrgvqelllkllpddrspgihrd

Timeline for d1qtta_:

• d1qtta_ first appeared (with stable ids) in SCOP 1.55
  
• d1qtta_ appears in SCOPe 2.05
  
• d1qtta_ appears in SCOPe 2.07
  
• d1qtta_ appears in the current release, SCOPe 2.08