Lineage for d5a3ib_ (5a3i B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970032Species Influenza a virus (a/vietnam/1203/2004(h5n1)) [TaxId:644788] [275158] (1 PDB entry)
  8. 1970033Domain d5a3ib_: 5a3i B: [275159]
    Other proteins in same PDB: d5a3ia_, d5a3id1, d5a3id2, d5a3ie_, d5a3ih1, d5a3ih2
    automated match to d2fk0b1
    complexed with nag; mutant

Details for d5a3ib_

PDB Entry: 5a3i (more details), 2.89 Å

PDB Description: crystal structure of a complex formed between fld194 fab and transmissible mutant h5 haemagglutinin
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5a3ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a3ib_ h.3.1.1 (B:) automated matches {Influenza a virus (a/vietnam/1203/2004(h5n1)) [TaxId: 644788]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea

SCOPe Domain Coordinates for d5a3ib_:

Click to download the PDB-style file with coordinates for d5a3ib_.
(The format of our PDB-style files is described here.)

Timeline for d5a3ib_: