SCOPe 2.06: Domain d5a3od_: 5a3o D:

Lineage for d5a3od_ (5a3o D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82029] (11 PDB entries)
   Uniprot Q9HYN5 # PA3361

8. Domain d5a3od_: 5a3o D: [275156]
   automated match to d1uzva_
   complexed with ca, cl, dh6, mma

Details for d5a3od_

PDB Entry: 5a3o, 1.6 Å

PDB Description: crystal structure of the lecb lectin from pseudomonas aeruginosa in complex with methyl 6-(cinnamido)-6-deoxy-alpha-d-mannopyranoside at 1.6 ansgtrom

PDB Compounds: (D:) Fucose-binding lectin PA-IIL

SCOPe Domain Sequences for d5a3od_:

Sequence; same for both SEQRES and ATOM records:

>d5a3od_ b.115.1.1 (D:) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d5a3od_:

• d5a3od_ first appeared in SCOPe 2.05
  
• d5a3od_ appears in SCOPe 2.07
  
• d5a3od_ appears in the current release, SCOPe 2.08